Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialanimalsgardenswildflowerinsectstropicalbiodiversity
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Chinese Peony from Flowers
Bee from Cartoon animals viii coloring book
Bug from Animals
Butterfly from Cartoon animals vii coloring book
Hibiscus Flower from Hawaii flower
Spring Crocus from Crocus
Cherokee Rose from Roses
Common Fruit Bats from Realistic animals coloring book
Hibiscus from Realistic flowers
American Redstart Birds and Honeycomb from Animals
Dendrobium Nobile Orchid from Orchid
Chrysanthemum 3 from Perennial
Charisma Yellow Red Floribunda Rose from Roses
Solidago or Goldenrod from Goldenrod
Golden Showers Climbing Rose from Roses
Chrysanthemum 4 from Perennial
Duchesse de Brabant Rose Bush from Roses
Lavender from Plants ii coloring book
Bee from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Pollinators of Alaska from Nps
Iris Motif from Iris
Orchid Lycaste Aromatica from Orchid
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Black Elderberry from Elderberry
Iris Flower Blossom from Iris
Chrysanthemum 1 from Perennial
Double Delight Hybrid Tea Rose from Roses
Disa Kewensis Orchid from Orchid
Butterfly from Cartoon animals viii coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Cosmos Scabiosoides from Cosmos
Steampunk Bee from Steampunk animals coloring book
Apple Blossom Branch from Apple tree
Bee from Cartoon animals v coloring book
Daffodil from Daffodil
Bumblebee from Woodland animals
Swallow Tail Hummingbird from Hummingbirds
Cirsium Vulgare or Bull Thistle from Thistle
Schlumbergera Bloom from Cactus
Aquilegia Truncata Red Columbine from Columbine
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Viola Adunca or Pale Mountain Violet from Violet
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Oriental poppy from Perennial
Daffodil Flowers from Daffodil
Clarkia Amoena Farewell to Spring from Godetia
American Twinflower from Celebrating wildflowers coloring book
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Daisy from Simple objects iv coloring book
Bumblebee from Bumblebee
Bumblebee from Simple objects coloring book
Ladybug from Cartoon animals v coloring book
Realistic Sunflowers from Sunflower
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Big-Headed Clover from Celebrating wildflowers coloring book
Black Locust from Locust tree
Pink Hibiscus from Realistic flowers
Life Cycle of Monarch Butterfly from Biology
Chrysanthemum Morifolium from Flower garden
Blooming Sunflower from Sunflower
Daffodil from Daffodil
Anemone Coronaria from Anemone
Chrysanthemum Carinatum from Realistic flowers
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Hummingbird from Cartoon animals ii coloring book
Bluebell Bellflower from Bellflower
Cornflower, Blue Bottle from Cornflowers
Heliconia Psittacorum from Heliconia
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Ranunculus Acris from Buttercup
Scarlet Carnation from Carnation
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Butterfly Flies On A Flower from Flowers
Aster or Star Plant from Asters
Burke's Larkspur from Celebrating wildflowers coloring book
Tropical Vanda Tricolor Orchid from Orchid
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
Grasshopper on Flower from Grasshoppers
Common Evening Primrose or Evening Star from Primrose
Grasshopper in Garden from Grasshoppers
Aster 1 from Asters
Sophronitis Cernua Orchid from Orchid
Italian Orchid Orchis Italica from Orchid
201 - 300 of 1,830 Next page
/ 19